PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARR-B
Protein Properties Length: 715aa    MW: 77094.9 Da    PI: 6.8168
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07857genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.63.3e-24212261151
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
               +pr++W+ eLH++Fv av++L G++kA+Pk+ilelm+v+ Lt+e+v+SHLQ
  EMT07857 212 RPRVVWSVELHRKFVAAVNHL-GIDKAVPKRILELMNVEKLTRENVASHLQ 261
               59*******************.***************************** PP

2Response_reg76.78.2e-26231311109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l++ +y +v+++ ++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +ge +++ + +  Ga 
      EMT07857  23 VLAVDDDPVCLKVLETLLRRCQY-HVTATNQAVIALRMLRENRdmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGETKTVMKGITHGAC 117
                   799********************.***************99999********************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel++
      EMT07857 118 DYLLKPVRIEELRN 131
                   ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23007.5E-4120175No hitNo description
SuperFamilySSF521723.13E-3420147IPR011006CheY-like superfamily
SMARTSM004485.8E-3021133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.75322137IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.8E-2323132IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.05E-2524136No hitNo description
PROSITE profilePS512949.422209269IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-24210262IPR009057Homeodomain-like
SuperFamilySSF466894.3E-15210262IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-22213262IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MRTDVRRGAA ATGMDQFPVG MRVLAVDDDP VCLKVLETLL RRCQYHVTAT NQAVIALRML  60
RENRDMFDLV ISDVHMPDMD GFKLLELVGL EMDLPVIMLS VNGETKTVMK GITHGACDYL  120
LKPVRIEELR NIWQHVVRRK FSTRDSVNLD TYEECNKPPS ADSDYVFGQV TCGSPDQSGR  180
PSKKRKEYHS EEEDEDEDSS GQDNDDPSAP KRPRVVWSVE LHRKFVAAVN HLGIDKAVPK  240
RILELMNVEK LTRENVASHL QASHLIYFLV VISRLVPCAF HTCRALSVLQ PAARHSEITF  300
AKYRLYLRRL SAVASQQAGI VAALGGRDPF LRMDAFEGLQ GYQAFTSPAA LSTFSAHGLL  360
NSPRNNQTAV VIQGVATSRS IPTGSSSCTT NPLIGDAAKY HLSLPGNQHG NLGQGLATSL  420
GQAQLQQKWM NEGSGDLSTI LSGNSRANGM PRMLPSVTSS PLLPPDLVEC TQAKVAIQPS  480
VRAPSASVEL LEGAIGASSG PLESRVSQQS ALPSSGFSAN MLPVHGSFNN NGASFSSNGA  540
TRLGDAFSAS FRPTNDLTVA RGTKVGAGSF GGTIHLSPDT EQKYLSFGSS DSLLDPKLVW  600
SSSQLPSNIG AHYHSMSQRS NNCSIDSSHG GRMFGQTSAS ASTAAPQTKF DILFSGDTSM  660
ARNASESGPQ RLQSELSSST CSFDGLLNSM IKVEKDDAAF GDDLGCDFYS LGACI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-22208261154ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3758490.0AK375849.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3107L06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570300.10.0PREDICTED: two-component response regulator ORR23
RefseqXP_014756381.10.0PREDICTED: two-component response regulator ORR23
SwissprotB8AEH10.0ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLM8ATR30.0M8ATR3_AEGTA; Two-component response regulator ARR12
STRINGMLOC_76165.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18563894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-101response regulator 12